Recombinant Human PPP1R17 Protein, GST-Tagged
| Cat.No. : | PPP1R17-0134H |
| Product Overview : | Human C7orf16 full-length ORF (NP_006649.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
| Molecular Mass : | 44.3 kDa |
| AA Sequence : | MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PPP1R17 protein phosphatase 1, regulatory subunit 17 [ Homo sapiens ] |
| Official Symbol | PPP1R17 |
| Synonyms | PPP1R17; protein phosphatase 1, regulatory subunit 17; C7orf16, chromosome 7 open reading frame 16; protein phosphatase 1 regulatory subunit 17; G substrate; GSBS; G-substrate; C7orf16; |
| Gene ID | 10842 |
| mRNA Refseq | NM_001145123 |
| Protein Refseq | NP_001138595 |
| MIM | 604088 |
| UniProt ID | O96001 |
| ◆ Recombinant Proteins | ||
| PPP1R17-7011M | Recombinant Mouse PPP1R17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPP1R17-3675H | Recombinant Human PPP1R17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Ppp1r17-5067M | Recombinant Mouse Ppp1r17 Protein, Myc/DDK-tagged | +Inquiry |
| PPP1R17-13226M | Recombinant Mouse PPP1R17 Protein | +Inquiry |
| PPP1R17-0134H | Recombinant Human PPP1R17 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1R17-7974HCL | Recombinant Human C7orf16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R17 Products
Required fields are marked with *
My Review for All PPP1R17 Products
Required fields are marked with *
