Recombinant Human PPP1R2

Cat.No. : PPP1R2-31217TH
Product Overview : Recombinant fragment corresponding to amino acids 1-100 of Human Protein phosphatase 1 inhibitor subunit 2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Protein phosphatase inhibitor 2 is an enzyme that in humans is encoded by the PPP1R2 gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
Sequence Similarities : Belongs to the protein phosphatase inhibitor 2 family.
Gene Name PPP1R2 protein phosphatase 1, regulatory (inhibitor) subunit 2 [ Homo sapiens ]
Official Symbol PPP1R2
Synonyms PPP1R2; protein phosphatase 1, regulatory (inhibitor) subunit 2; protein phosphatase inhibitor 2; IPP2;
Gene ID 5504
mRNA Refseq NM_006241
Protein Refseq NP_006232
MIM 601792
Uniprot ID P41236
Chromosome Location 3q29
Function protein binding; protein serine/threonine phosphatase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R2 Products

Required fields are marked with *

My Review for All PPP1R2 Products

Required fields are marked with *

0
cart-icon