Recombinant Human PPP1R8
Cat.No. : | PPP1R8-26964TH |
Product Overview : | Recombinant fragment of Human NIPP1, Isoform Gamma with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI |
Sequence Similarities : | Contains 1 FHA domain. |
Gene Name | PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ] |
Official Symbol | PPP1R8 |
Synonyms | PPP1R8; protein phosphatase 1, regulatory subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; nuclear inhibitor of protein phosphatase 1; activator of RNA decay; ard 1; ARD1; NIPP 1; NIPP1; nuclear subunit of PP 1; PRO2047; protein phospha |
Gene ID | 5511 |
mRNA Refseq | NM_002713 |
Protein Refseq | NP_002704 |
MIM | 602636 |
Uniprot ID | Q12972 |
Chromosome Location | 1p35.3 |
Function | DNA binding; RNA binding; endonuclease activity; hydrolase activity; protein binding; |
◆ Recombinant Proteins | ||
PPP1R8-3387R | Recombinant Rhesus Macaque PPP1R8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ppp1r8-026M | Recombinant Mouse Ppp1r8 Protein, MYC/DDK-tagged | +Inquiry |
PPP1R8-2143H | Recombinant Human PPP1R8 Protein (1-209 aa), GST-tagged | +Inquiry |
PPP1R8-2580C | Recombinant Chicken PPP1R8 | +Inquiry |
PPP1R8-1897H | Recombinant Human PPP1R8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R8-2932HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
PPP1R8-2931HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R8 Products
Required fields are marked with *
My Review for All PPP1R8 Products
Required fields are marked with *
0
Inquiry Basket