Recombinant Human PPP1R8

Cat.No. : PPP1R8-26964TH
Product Overview : Recombinant fragment of Human NIPP1, Isoform Gamma with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Sequence Similarities : Contains 1 FHA domain.
Gene Name PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ]
Official Symbol PPP1R8
Synonyms PPP1R8; protein phosphatase 1, regulatory subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; nuclear inhibitor of protein phosphatase 1; activator of RNA decay; ard 1; ARD1; NIPP 1; NIPP1; nuclear subunit of PP 1; PRO2047; protein phospha
Gene ID 5511
mRNA Refseq NM_002713
Protein Refseq NP_002704
MIM 602636
Uniprot ID Q12972
Chromosome Location 1p35.3
Function DNA binding; RNA binding; endonuclease activity; hydrolase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R8 Products

Required fields are marked with *

My Review for All PPP1R8 Products

Required fields are marked with *

0
cart-icon