Recombinant Human PPP1R8 Protein (1-209 aa), GST-tagged
Cat.No. : | PPP1R8-2143H |
Product Overview : | Recombinant Human PPP1R8 Protein (1-209 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-209 aa |
Description : | Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 52.1 kDa |
AA Sequence : | MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ] |
Official Symbol | PPP1R8 |
Synonyms | PPP1R8; ard 1; ARD1; NIPP 1; NIPP1; PRO2047; RNase E; RD-1; NIPP-1; |
Gene ID | 5511 |
mRNA Refseq | NM_002713 |
Protein Refseq | NP_002704 |
MIM | 602636 |
UniProt ID | Q12972 |
◆ Recombinant Proteins | ||
PPP1R8-26964TH | Recombinant Human PPP1R8 | +Inquiry |
Ppp1r8-026M | Recombinant Mouse Ppp1r8 Protein, MYC/DDK-tagged | +Inquiry |
PPP1R8-2143H | Recombinant Human PPP1R8 Protein (1-209 aa), GST-tagged | +Inquiry |
PPP1R8-2580C | Recombinant Chicken PPP1R8 | +Inquiry |
PPP1R8-3569R | Recombinant Rhesus monkey PPP1R8 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R8-2931HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
PPP1R8-2932HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R8 Products
Required fields are marked with *
My Review for All PPP1R8 Products
Required fields are marked with *
0
Inquiry Basket