Recombinant Human PPP1R8 Protein (1-209 aa), GST-tagged
| Cat.No. : | PPP1R8-2143H |
| Product Overview : | Recombinant Human PPP1R8 Protein (1-209 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-209 aa |
| Description : | Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 52.1 kDa |
| AA Sequence : | MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ] |
| Official Symbol | PPP1R8 |
| Synonyms | PPP1R8; ard 1; ARD1; NIPP 1; NIPP1; PRO2047; RNase E; RD-1; NIPP-1; |
| Gene ID | 5511 |
| mRNA Refseq | NM_002713 |
| Protein Refseq | NP_002704 |
| MIM | 602636 |
| UniProt ID | Q12972 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R8 Products
Required fields are marked with *
My Review for All PPP1R8 Products
Required fields are marked with *
Recently Viewed
