Recombinant Human PPP2R2C
Cat.No. : | PPP2R2C-27932TH |
Product Overview : | Recombinant fragment of Human PPP2R2C with an N terminal proprietary tag; Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
Description : | The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLA TGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEF DYLKSLEIEEKINKIKWLPQQNAAHSLLST |
Sequence Similarities : | Belongs to the phosphatase 2A regulatory subunit B family.Contains 7 WD repeats. |
Gene Name : | PPP2R2C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ] |
Official Symbol : | PPP2R2C |
Synonyms : | PPP2R2C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform , protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform; IMYPNO; MGC33570; PP2A subunit B iso |
Gene ID : | 5522 |
mRNA Refseq : | NM_001206994 |
Protein Refseq : | NP_001193923 |
MIM : | 605997 |
Uniprot ID : | Q9Y2T4 |
Chromosome Location : | 4p16.1 |
Pathway : | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Glycogen Metabolism, organism-specific biosystem; |
Function : | protein phosphatase type 2A regulator activity; |
Products Types
◆ Recombinant Protein | ||
PPP2R2C-2762H | Recombinant Human PPP2R2C Protein (1-447 aa), His-Myc-tagged | +Inquiry |
PPP2R2C-7034M | Recombinant Mouse PPP2R2C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R2C-4295R | Recombinant Rat PPP2R2C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R2C-3390R | Recombinant Rhesus Macaque PPP2R2C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R2C-1917H | Recombinant Human PPP2R2C, GST-tagged | +Inquiry |
◆ Lysates | ||
PPP2R2C-1403HCL | Recombinant Human PPP2R2C cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket