Recombinant Human PPP2R2C

Cat.No. : PPP2R2C-27932TH
Product Overview : Recombinant fragment of Human PPP2R2C with an N terminal proprietary tag; Predicted MW 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLA TGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEF DYLKSLEIEEKINKIKWLPQQNAAHSLLST
Sequence Similarities : Belongs to the phosphatase 2A regulatory subunit B family.Contains 7 WD repeats.
Gene Name PPP2R2C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ]
Official Symbol PPP2R2C
Synonyms PPP2R2C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform , protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform; IMYPNO; MGC33570; PP2A subunit B iso
Gene ID 5522
mRNA Refseq NM_001206994
Protein Refseq NP_001193923
MIM 605997
Uniprot ID Q9Y2T4
Chromosome Location 4p16.1
Pathway Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Glycogen Metabolism, organism-specific biosystem;
Function protein phosphatase type 2A regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R2C Products

Required fields are marked with *

My Review for All PPP2R2C Products

Required fields are marked with *

0
cart-icon