Recombinant Human PPP3R2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PPP3R2-1848H |
| Product Overview : | PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. |
| Molecular Mass : | 19.9 kDa |
| AA Sequence : | MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PPP3R2 protein phosphatase 3 regulatory subunit B, beta [ Homo sapiens (human) ] |
| Official Symbol | PPP3R2 |
| Synonyms | PPP3R2; protein phosphatase 3, regulatory subunit B, beta; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II), protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; calcineurin subunit B type 2; calcineurin B; type II (19kDa); PPP3RL; protein phosphatase 2B regulatory subunit 2; protein phosphatase 3; regulatory subunit B (calcineurin B) like; CBLP; CNBII; calcineurin BII; calcineurin B-like protein; calcineurin B, type II (19kDa); protein phosphatase 3 regulatory subunit B beta isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II); |
| Gene ID | 5535 |
| mRNA Refseq | NM_147180 |
| Protein Refseq | NP_671709 |
| MIM | 613821 |
| UniProt ID | Q96LZ3 |
| ◆ Recombinant Proteins | ||
| Ppp3r2-5083M | Recombinant Mouse Ppp3r2 Protein, Myc/DDK-tagged | +Inquiry |
| PPP3R2-1924H | Recombinant Human PPP3R2, GST-tagged | +Inquiry |
| PPP3R2-4642R | Recombinant Rat PPP3R2 Protein | +Inquiry |
| PPP3R2-29542TH | Recombinant Human PPP3R2, His-tagged | +Inquiry |
| Ppp3r2-1974M | Recombinant Mouse Ppp3r2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP3R2-2912HCL | Recombinant Human PPP3R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP3R2 Products
Required fields are marked with *
My Review for All PPP3R2 Products
Required fields are marked with *
