Recombinant Human PPPDE1 protein, His-tagged
Cat.No. : | PPPDE1-3990H |
Product Overview : | Recombinant Human PPPDE1 protein(1-194 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-194 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PPPDE1 PPPDE peptidase domain containing 1 [ Homo sapiens ] |
Official Symbol | PPPDE1 |
Synonyms | PPPDE1; PPPDE peptidase domain containing 1; C1orf121, chromosome 1 open reading frame 121 , FAM152A, family with sequence similarity 152, member A , PPPDE peptidase domain containing 1 , PPPDE1; PPPDE peptidase domain-containing protein 1; CGI 146; FLJ21998; family with sequence similarity 152, member A; PNAS-4; CGI-146; FAM152A; C1orf121; |
Gene ID | 51029 |
mRNA Refseq | NM_016076 |
Protein Refseq | NP_057160 |
UniProt ID | Q9BSY9 |
◆ Recombinant Proteins | ||
PPPDE1-1929H | Recombinant Human PPPDE1, GST-tagged | +Inquiry |
PPPDE1-1838C | Recombinant Chicken PPPDE1 | +Inquiry |
PPPDE1-3397R | Recombinant Rhesus Macaque PPPDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPPDE1-3990H | Recombinant Human PPPDE1 protein, His-tagged | +Inquiry |
PPPDE1-3579R | Recombinant Rhesus monkey PPPDE1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPPDE1-2907HCL | Recombinant Human PPPDE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPPDE1 Products
Required fields are marked with *
My Review for All PPPDE1 Products
Required fields are marked with *