Recombinant Human PQBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PQBP1-5715H
Product Overview : PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Molecular Mass : 30.5 kDa
AA Sequence : MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PQBP1 polyglutamine binding protein 1 [ Homo sapiens (human) ]
Official Symbol PQBP1
Synonyms PQBP1; polyglutamine binding protein 1; mental retardation, X linked 55, MRX55, MRXS8, RENS1, SHS, Sutherland Haan X linked mental retardation syndrome; polyglutamine-binding protein 1; polyglutamine tract-binding protein 1; nuclear protein containing WW domain 38 kD; 38 kDa nuclear protein containing a WW domain; SHS; MRX55; MRXS3; MRXS8; NPW38; RENS1;
Gene ID 10084
mRNA Refseq NM_001032383
Protein Refseq NP_001027555
MIM 300463
UniProt ID O60828

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PQBP1 Products

Required fields are marked with *

My Review for All PQBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon