Recombinant Human PQBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PQBP1-5715H |
Product Overview : | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PQBP1 polyglutamine binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | PQBP1 |
Synonyms | PQBP1; polyglutamine binding protein 1; mental retardation, X linked 55, MRX55, MRXS8, RENS1, SHS, Sutherland Haan X linked mental retardation syndrome; polyglutamine-binding protein 1; polyglutamine tract-binding protein 1; nuclear protein containing WW domain 38 kD; 38 kDa nuclear protein containing a WW domain; SHS; MRX55; MRXS3; MRXS8; NPW38; RENS1; |
Gene ID | 10084 |
mRNA Refseq | NM_001032383 |
Protein Refseq | NP_001027555 |
MIM | 300463 |
UniProt ID | O60828 |
◆ Recombinant Proteins | ||
PQBP1-6773H | Recombinant Human Polyglutamine Binding Protein 1, His-tagged | +Inquiry |
PQBP1-568Z | Recombinant Zebrafish PQBP1 | +Inquiry |
PQBP1-3402R | Recombinant Rhesus Macaque PQBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PQBP1-4239H | Recombinant Human PQBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PQBP1-1933H | Recombinant Human PQBP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PQBP1-2903HCL | Recombinant Human PQBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PQBP1 Products
Required fields are marked with *
My Review for All PQBP1 Products
Required fields are marked with *
0
Inquiry Basket