Recombinant Human PRADC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRADC1-2315H |
| Product Overview : | C2orf7 MS Standard C13 and N15-labeled recombinant protein (NP_115695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Plays a role in the modulation of physical activity and adiposity. |
| Molecular Mass : | 21 kDa |
| AA Sequence : | MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRADC1 protease-associated domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | PRADC1 |
| Synonyms | C2orf7; hPAP21; MGC13004; PADC1_HUMAN; PAP21; Pradc1; Protease associated domain containing 1; Protease-associated domain-containing protein 1; Protease-associated domain-containing protein of 21 kDa; PRADC1 |
| Gene ID | 84279 |
| mRNA Refseq | NM_032319 |
| Protein Refseq | NP_115695 |
| UniProt ID | Q9BSG0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRADC1 Products
Required fields are marked with *
My Review for All PRADC1 Products
Required fields are marked with *



