Recombinant Human PRADC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRADC1-2315H
• Product Overview: C2orf7 MS Standard C13 and N15-labeled recombinant protein (NP_115695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Plays a role in the modulation of physical activity and adiposity.
• Molecular Mass: 21 kDa
• AA Sequence: MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRADC1 protease-associated domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: PRADC1
• Synonyms: C2orf7; hPAP21; MGC13004; PADC1_HUMAN; PAP21; Pradc1; Protease associated domain containing 1; Protease-associated domain-containing protein 1; Protease-associated domain-containing protein of 21 kDa; PRADC1
• Gene ID: 84279
• mRNA Refseq: NM_032319
• Protein Refseq: NP_115695
• UniProt ID: Q9BSG0