Recombinant Human PRADC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRADC1-2315H |
Product Overview : | C2orf7 MS Standard C13 and N15-labeled recombinant protein (NP_115695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Plays a role in the modulation of physical activity and adiposity. |
Molecular Mass : | 21 kDa |
AA Sequence : | MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRADC1 protease-associated domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | PRADC1 |
Synonyms | C2orf7; hPAP21; MGC13004; PADC1_HUMAN; PAP21; Pradc1; Protease associated domain containing 1; Protease-associated domain-containing protein 1; Protease-associated domain-containing protein of 21 kDa; PRADC1 |
Gene ID | 84279 |
mRNA Refseq | NM_032319 |
Protein Refseq | NP_115695 |
UniProt ID | Q9BSG0 |
◆ Recombinant Proteins | ||
PRADC1-2315H | Recombinant Human PRADC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRADC1-0048H | Recombinant Human PRADC1 Protein (His22-Trp188), C-His-tagged | +Inquiry |
PRADC1-13291M | Recombinant Mouse PRADC1 Protein | +Inquiry |
PRADC1-7057M | Recombinant Mouse PRADC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pradc1-5092M | Recombinant Mouse Pradc1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRADC1-8064HCL | Recombinant Human C2orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRADC1 Products
Required fields are marked with *
My Review for All PRADC1 Products
Required fields are marked with *