Recombinant Human PRADC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRADC1-2315H
Product Overview : C2orf7 MS Standard C13 and N15-labeled recombinant protein (NP_115695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Plays a role in the modulation of physical activity and adiposity.
Molecular Mass : 21 kDa
AA Sequence : MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRADC1 protease-associated domain containing 1 [ Homo sapiens (human) ]
Official Symbol PRADC1
Synonyms C2orf7; hPAP21; MGC13004; PADC1_HUMAN; PAP21; Pradc1; Protease associated domain containing 1; Protease-associated domain-containing protein 1; Protease-associated domain-containing protein of 21 kDa; PRADC1
Gene ID 84279
mRNA Refseq NM_032319
Protein Refseq NP_115695
UniProt ID Q9BSG0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRADC1 Products

Required fields are marked with *

My Review for All PRADC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon