Recombinant Human PRAF2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRAF2-5070H |
| Product Overview : | PRAF2 MS Standard C13 and N15-labeled recombinant protein (NP_009144) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | PRAF2 (PRA1 Domain Family Member 2) is a Protein Coding gene. Diseases associated with PRAF2 include Neuroblastoma. An important paralog of this gene is ARL6IP5. |
| Molecular Mass : | 19.3 kDa |
| AA Sequence : | MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRAF2 PRA1 domain family member 2 [ Homo sapiens (human) ] |
| Official Symbol | PRAF2 |
| Synonyms | PRAF2; PRA1 domain family, member 2; PRA1 domain family 2; PRA1 family protein 2; JM4; Jena-Muenchen 4; FLJ57916; |
| Gene ID | 11230 |
| mRNA Refseq | NM_007213 |
| Protein Refseq | NP_009144 |
| MIM | 300840 |
| UniProt ID | O60831 |
| ◆ Cell & Tissue Lysates | ||
| PRAF2-2899HCL | Recombinant Human PRAF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRAF2 Products
Required fields are marked with *
My Review for All PRAF2 Products
Required fields are marked with *
