Recombinant Human PRAF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRAF2-5070H
• Product Overview: PRAF2 MS Standard C13 and N15-labeled recombinant protein (NP_009144) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PRAF2 (PRA1 Domain Family Member 2) is a Protein Coding gene. Diseases associated with PRAF2 include Neuroblastoma. An important paralog of this gene is ARL6IP5.
• Molecular Mass: 19.3 kDa
• AA Sequence: MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRAF2 PRA1 domain family member 2 [ Homo sapiens (human) ]
• Official Symbol: PRAF2
• Synonyms: PRAF2; PRA1 domain family, member 2; PRA1 domain family 2; PRA1 family protein 2; JM4; Jena-Muenchen 4; FLJ57916
• Gene ID: 11230
• mRNA Refseq: NM_007213
• Protein Refseq: NP_009144
• MIM: 300840
• UniProt ID: O60831