Recombinant Human PRC1 protein, GST-tagged
Cat.No. : | PRC1-528H |
Product Overview : | Recombinant Human PRC1 protein(NP_003972)(13-175 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 13-175 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | VCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | PRC1 protein regulator of cytokinesis 1 [ Homo sapiens ] |
Official Symbol | PRC1 |
Synonyms | PRC1; protein regulator of cytokinesis 1; anaphase spindle elongation 1 homolog (S. cerevisiae); ASE1; protein regulating cytokinesis 1; anaphase spindle elongation 1 homolog; MGC1671; MGC3669; |
Gene ID | 9055 |
mRNA Refseq | NM_003981 |
Protein Refseq | NP_003972 |
MIM | 603484 |
UniProt ID | O43663 |
◆ Recombinant Proteins | ||
PRC1-528H | Recombinant Human PRC1 protein, GST-tagged | +Inquiry |
PRC1-1623HFL | Recombinant Full Length Human PRC1 Protein, C-Flag-tagged | +Inquiry |
PRC1-3585C | Recombinant Chicken PRC1 | +Inquiry |
PRC1-1755H | Recombinant Human PRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prc1-5097M | Recombinant Mouse Prc1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRC1-459HCL | Recombinant Human PRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRC1 Products
Required fields are marked with *
My Review for All PRC1 Products
Required fields are marked with *