Recombinant Human PRCP protein, His-tagged
Cat.No. : | PRCP-3113H |
Product Overview : | Recombinant Human PRCP(Leu22-His496a) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Leu22-His496 |
Description : | Lysosomal Pro-X Carboxypeptidase (PRCP) belongs to the peptidase S28 family. PRCP is detected in many tissues, with highest levels observed in placenta, lung, and liver. It is also present in the heart, brain, pancreas, and kidney. PRCP exists as a homodimer. PRCP cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. PRCP has been shown to be an activator of the cell matrix-associated prekallikrein. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM NaAc-HAc, 150mM NaCl, 10%Glycerol, pH4.5. |
AA Sequence : | LRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSI LFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQAL ADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCG VFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISE TWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNI SETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMY GGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSL EVRHMKNWIRDFYDSAGKQHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Gene Name | PRCP prolylcarboxypeptidase (angiotensinase C) [ Homo sapiens ] |
Official Symbol | PRCP |
Synonyms | PRCP; prolylcarboxypeptidase (angiotensinase C); lysosomal Pro-X carboxypeptidase; HUMPCP; PCP; angiotensinase C; proline carboxypeptidase; lysosomal carboxypeptidase C; prolylcarboxypeptidase isoform 1 preproprotein; MGC2202; |
Gene ID | 5547 |
mRNA Refseq | NM_005040 |
Protein Refseq | NP_005031 |
MIM | 176785 |
UniProt ID | P42785 |
Chromosome Location | 11q14 |
Pathway | Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Hemostasis, organism-specific biosystem; Intrinsic Pathway, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | peptidase activity; protein binding; serine-type carboxypeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
PRCP-798Z | Recombinant Zebrafish PRCP | +Inquiry |
PRCP-6727H | Recombinant Human PRCP protein, His & T7-tagged | +Inquiry |
PRCP-5975H | Recombinant Human PRCP Protein (Asp108-Val376), N-His tagged | +Inquiry |
PRCP-653H | Recombinant Full Length Human PRCP Protein, His-tagged | +Inquiry |
PRCP-23H | Active Recombinant Human PRCP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRCP-2888HCL | Recombinant Human PRCP 293 Cell Lysate | +Inquiry |
PRCP-2889HCL | Recombinant Human PRCP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRCP Products
Required fields are marked with *
My Review for All PRCP Products
Required fields are marked with *