Recombinant Human PRG4, GST-tagged

Cat.No. : PRG4-1501H
Product Overview : Recombinant Human PRG4 encoding (1305 a.a. - 1404 a.a.), fused a GST-tag at N-terminal, was expressed in Wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 36.74 kDa
Purity : Glutathione Sepharose 4 Fast Flow
Applications : WB
Sequence : ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNID VPSRTARAITTRSGQTLSKVWYNCP
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : PRG4
Gene Name PRG4 proteoglycan 4 [ Homo sapiens ]
Synonyms PRG4; proteoglycan 4; MSF; SZP; CACP; HAPO; JCAP; FLJ32635; bG174L6.2; lubricin; OTTHUMP00000033580; megakaryocyte stimulating factor; articular superficial zone protein; bG174L6.2 (MSF: megakaryocyte stimulating factor ); proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome); Megakaryocyte-stimulating factor; Superficial zone proteoglycan; Proteoglycan 4 C-terminal part
Gene ID 10216
mRNA Refseq NM_005807
Protein Refseq NP_005798
MIM 604283
UniProt ID Q92954
Chromosome Location 1q25-q31
Function polysaccharide binding; protein binding; scavenger receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRG4 Products

Required fields are marked with *

My Review for All PRG4 Products

Required fields are marked with *

0
cart-icon
0
compare icon