Recombinant Human PRKCG protein, His-tagged
Cat.No. : | PRKCG-3423H |
Product Overview : | Recombinant Human PRKCG protein(351-697 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-697 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PRKCG protein kinase C, gamma [ Homo sapiens ] |
Official Symbol | PRKCG |
Synonyms | PRKCG; protein kinase C, gamma; PKCG, SCA14; protein kinase C gamma type; MGC57564; PKC gamma; PKCC; PKCG; SCA14; PKC-gamma; |
Gene ID | 5582 |
mRNA Refseq | NM_002739 |
Protein Refseq | NP_002730 |
MIM | 176980 |
UniProt ID | P05129 |
◆ Recombinant Proteins | ||
PRKCG-3423H | Recombinant Human PRKCG protein, His-tagged | +Inquiry |
PRKCG-13366M | Recombinant Mouse PRKCG Protein | +Inquiry |
PRKCG-4339R | Recombinant Rat PRKCG Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKCG-3348HFL | Recombinant Full Length Human PRKCG protein, Flag-tagged | +Inquiry |
PRKCG-405H | Recombinant Full Length Human PRKCG Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCG-2856HCL | Recombinant Human PRKCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKCG Products
Required fields are marked with *
My Review for All PRKCG Products
Required fields are marked with *
0
Inquiry Basket