Recombinant Human PRKG1 protein, His-tagged
Cat.No. : | PRKG1-5633H |
Product Overview : | Recombinant Human PRKG1 protein(1-178 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-178 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PRKG1 protein kinase, cGMP-dependent, type I [ Homo sapiens ] |
Official Symbol | PRKG1 |
Synonyms | PRKG1; protein kinase, cGMP-dependent, type I; PRKG1B, PRKGR1B; cGMP-dependent protein kinase 1; PGK; PKG; protein kinase, cGMP-dependent, regulatory, type I, beta; 1; cGK; cGK1; cGKI; cGK 1; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha; FLJ36117; MGC71944; DKFZp686K042; |
Gene ID | 5592 |
mRNA Refseq | NM_001098512 |
Protein Refseq | NP_001091982 |
MIM | 176894 |
UniProt ID | Q13976 |
◆ Recombinant Proteins | ||
PRKG1-26452TH | Recombinant Human PRKG1 | +Inquiry |
PRKG1-564H | Recombinant Human PRKG1, His-tagged | +Inquiry |
PRKG1-1102H | Recombinant Human PRKG1 Protein (M1-F686), Tag Free | +Inquiry |
PRKG1-1767H | Recombinant Human PRKG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKG1-157HFL | Active Recombinant Full Length Human PRKG1 Protein, N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKG1-2850HCL | Recombinant Human PRKG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKG1 Products
Required fields are marked with *
My Review for All PRKG1 Products
Required fields are marked with *