Recombinant Human PRKRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRKRIP1-3663H |
Product Overview : | PRKRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_078929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PRKRIP1 (PRKR Interacting Protein 1) is a Protein Coding gene. Diseases associated with PRKRIP1 include Fructose-1,6-Bisphosphatase Deficiency and Familial Febrile Seizures. Gene Ontology (GO) annotations related to this gene include protein kinase binding and protein kinase inhibitor activity. |
Molecular Mass : | 21 kDa |
AA Sequence : | MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRKRIP1 PRKR interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | PRKRIP1 |
Synonyms | PRKRIP1; PRKR interacting protein 1 (IL11 inducible); PRKR-interacting protein 1; C114; FLJ13902; KRAB box domain containing 3; KRBOX3; likely ortholog of mouse C114 dsRNA binding protein; likely ortholog of mouse C114 dsRNA-binding protein; FLJ40957; |
Gene ID | 79706 |
mRNA Refseq | NM_024653 |
Protein Refseq | NP_078929 |
MIM | 617458 |
UniProt ID | Q9H875 |
◆ Recombinant Proteins | ||
PRKRIP1-13379M | Recombinant Mouse PRKRIP1 Protein | +Inquiry |
Prkrip1-5128M | Recombinant Mouse Prkrip1 Protein, Myc/DDK-tagged | +Inquiry |
PRKRIP1-1961H | Recombinant Human PRKRIP1, His-tagged | +Inquiry |
PRKRIP1-2613Z | Recombinant Zebrafish PRKRIP1 | +Inquiry |
PRKRIP1-3663H | Recombinant Human PRKRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKRIP1-2847HCL | Recombinant Human PRKRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKRIP1 Products
Required fields are marked with *
My Review for All PRKRIP1 Products
Required fields are marked with *