Recombinant Human PRKRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRKRIP1-3663H
Product Overview : PRKRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_078929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PRKRIP1 (PRKR Interacting Protein 1) is a Protein Coding gene. Diseases associated with PRKRIP1 include Fructose-1,6-Bisphosphatase Deficiency and Familial Febrile Seizures. Gene Ontology (GO) annotations related to this gene include protein kinase binding and protein kinase inhibitor activity.
Molecular Mass : 21 kDa
AA Sequence : MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRKRIP1 PRKR interacting protein 1 [ Homo sapiens (human) ]
Official Symbol PRKRIP1
Synonyms PRKRIP1; PRKR interacting protein 1 (IL11 inducible); PRKR-interacting protein 1; C114; FLJ13902; KRAB box domain containing 3; KRBOX3; likely ortholog of mouse C114 dsRNA binding protein; likely ortholog of mouse C114 dsRNA-binding protein; FLJ40957;
Gene ID 79706
mRNA Refseq NM_024653
Protein Refseq NP_078929
MIM 617458
UniProt ID Q9H875

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKRIP1 Products

Required fields are marked with *

My Review for All PRKRIP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon