Recombinant Human PRLH Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRLH-6358H |
Product Overview : | PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL. |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRLH prolactin releasing hormone [ Homo sapiens (human) ] |
Official Symbol | PRLH |
Synonyms | PRLH; prolactin releasing hormone; prolactin-releasing peptide; PRH; prolactin-releasing hormone; preproprolactin-releasing peptide; PRRP; |
Gene ID | 51052 |
mRNA Refseq | NM_015893 |
Protein Refseq | NP_056977 |
MIM | 602663 |
UniProt ID | P81277 |
◆ Recombinant Proteins | ||
PRLH-3674C | Recombinant Chicken PRLH | +Inquiry |
PRLH-4358R | Recombinant Rat PRLH Protein, His (Fc)-Avi-tagged | +Inquiry |
PRLH-4699R | Recombinant Rat PRLH Protein | +Inquiry |
PRLH-8085Z | Recombinant Zebrafish PRLH | +Inquiry |
Prlh-5131M | Recombinant Mouse Prlh Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRLH-2843HCL | Recombinant Human PRLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRLH Products
Required fields are marked with *
My Review for All PRLH Products
Required fields are marked with *
0
Inquiry Basket