Recombinant Human PRLH Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRLH-6358H
Product Overview : PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.
Molecular Mass : 9.6 kDa
AA Sequence : MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRLH prolactin releasing hormone [ Homo sapiens (human) ]
Official Symbol PRLH
Synonyms PRLH; prolactin releasing hormone; prolactin-releasing peptide; PRH; prolactin-releasing hormone; preproprolactin-releasing peptide; PRRP;
Gene ID 51052
mRNA Refseq NM_015893
Protein Refseq NP_056977
MIM 602663
UniProt ID P81277

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRLH Products

Required fields are marked with *

My Review for All PRLH Products

Required fields are marked with *

0
cart-icon
0
compare icon