Recombinant Human PRLH Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRLH-6358H |
| Product Overview : | PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL. |
| Molecular Mass : | 9.6 kDa |
| AA Sequence : | MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRLH prolactin releasing hormone [ Homo sapiens (human) ] |
| Official Symbol | PRLH |
| Synonyms | PRLH; prolactin releasing hormone; prolactin-releasing peptide; PRH; prolactin-releasing hormone; preproprolactin-releasing peptide; PRRP; |
| Gene ID | 51052 |
| mRNA Refseq | NM_015893 |
| Protein Refseq | NP_056977 |
| MIM | 602663 |
| UniProt ID | P81277 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRLH Products
Required fields are marked with *
My Review for All PRLH Products
Required fields are marked with *
