Recombinant Human PRMT3 Protein, GST-tagged
Cat.No. : | PRMT3-5042H |
Product Overview : | Human HRMT1L3 partial ORF ( NP_005779, 41 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins (Tang et al., 1998 [PubMed 9642256]).[supplied by OMIM |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PRMT3 protein arginine methyltransferase 3 [ Homo sapiens ] |
Official Symbol | PRMT3 |
Synonyms | PRMT3; protein arginine methyltransferase 3; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HRMT1L3; protein arginine N-methyltransferase 3; HMT1 hnRNP methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3; HRMT1L3; |
Gene ID | 10196 |
mRNA Refseq | NM_001145166 |
Protein Refseq | NP_001138638 |
MIM | 603190 |
UniProt ID | O60678 |
◆ Recombinant Proteins | ||
PRMT3-7124M | Recombinant Mouse PRMT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT3-097H | Recombinant Human PRMT3 Protein, GST-tagged | +Inquiry |
PRMT3-4327C | Recombinant Chicken PRMT3 | +Inquiry |
PRMT3-119H | Recombinant Human PRMT3 protein, T7/His-tagged | +Inquiry |
PRMT3-007H | Active Recombinant Human PRMT3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT3 Products
Required fields are marked with *
My Review for All PRMT3 Products
Required fields are marked with *