Recombinant Human PRMT3 Protein, GST-tagged

Cat.No. : PRMT3-5042H
Product Overview : Human HRMT1L3 partial ORF ( NP_005779, 41 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins (Tang et al., 1998 [PubMed 9642256]).[supplied by OMIM
Molecular Mass : 36.63 kDa
AA Sequence : LPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PRMT3 protein arginine methyltransferase 3 [ Homo sapiens ]
Official Symbol PRMT3
Synonyms PRMT3; protein arginine methyltransferase 3; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HRMT1L3; protein arginine N-methyltransferase 3; HMT1 hnRNP methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3; HRMT1L3;
Gene ID 10196
mRNA Refseq NM_001145166
Protein Refseq NP_001138638
MIM 603190
UniProt ID O60678

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT3 Products

Required fields are marked with *

My Review for All PRMT3 Products

Required fields are marked with *

0
cart-icon