Recombinant Human PROC protein(51-190 aa), N-SUMO & C-His-tagged
| Cat.No. : | PROC-2537H |
| Product Overview : | Recombinant Human PROC protein(P04070)(51-190 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 51-190 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRM |
| Gene Name | PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ] |
| Official Symbol | PROC |
| Synonyms | PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4; |
| Gene ID | 5624 |
| mRNA Refseq | NM_000312 |
| Protein Refseq | NP_000303 |
| MIM | 612283 |
| UniProt ID | P04070 |
| ◆ Recombinant Proteins | ||
| Proc-26M | Active Recombinant Mouse Proc protein, His-tagged | +Inquiry |
| PROC-33H | Recombinant Human PROC protein, His-tagged | +Inquiry |
| PROC-3000H | Recombinant Human PROC Protein, MYC/DDK-tagged | +Inquiry |
| Proc-826M | Recombinant Mouse Proc protein, His & GST-tagged | +Inquiry |
| PROC-1772H | Recombinant Human PROC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
| PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
| PROC-64H | Active Native Human Activated Protein C | +Inquiry |
| PROC-269B | Active Native Bovine Protein C | +Inquiry |
| Proc-5346M | Native Mouse Protein C | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PROC-852HCL | Recombinant Human PROC cell lysate | +Inquiry |
| PROC-747MCL | Recombinant Mouse PROC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROC Products
Required fields are marked with *
My Review for All PROC Products
Required fields are marked with *



