Recombinant Human PROK2 Protein

Cat.No. : PROK2-412H
Product Overview : Recombinant Human PROK2, transcript variant 2, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Molecular Mass : 8.8 kDa
AA Sequence : AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name PROK2 prokineticin 2 [ Homo sapiens ]
Official Symbol PROK2
Synonyms PROK2; prokineticin 2; prokineticin-2; BV8; KAL4; MIT1; PK2; protein Bv8 homolog;
Gene ID 60675
mRNA Refseq NM_001126128
Protein Refseq NP_001119600
MIM 607002
UniProt ID Q9HC23

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROK2 Products

Required fields are marked with *

My Review for All PROK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon