Recombinant Human PROK2 Protein
Cat.No. : | PROK2-412H |
Product Overview : | Recombinant Human PROK2, transcript variant 2, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 8.8 kDa |
AA Sequence : | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | PROK2 prokineticin 2 [ Homo sapiens ] |
Official Symbol | PROK2 |
Synonyms | PROK2; prokineticin 2; prokineticin-2; BV8; KAL4; MIT1; PK2; protein Bv8 homolog; |
Gene ID | 60675 |
mRNA Refseq | NM_001126128 |
Protein Refseq | NP_001119600 |
MIM | 607002 |
UniProt ID | Q9HC23 |
◆ Recombinant Proteins | ||
PROK2-767H | Recombinant Human PROK2 protein, His & GST-tagged | +Inquiry |
PROK2-464H | Recombinant Human Prokineticin-2 | +Inquiry |
PROK2-7132M | Recombinant Mouse PROK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PROK2-6188H | Recombinant Human PROK2 Protein (Ile30-Gln128), N-GST tagged | +Inquiry |
Prok2-768M | Recombinant Mouse Prok2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROK2-2835HCL | Recombinant Human PROK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROK2 Products
Required fields are marked with *
My Review for All PROK2 Products
Required fields are marked with *