Recombinant Human PROM2 protein, His-SUMO-tagged
Cat.No. : | PROM2-5733H |
Product Overview : | Recombinant Human PROM2 protein(Q8N271)(27-106aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-106aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGY |
Gene Name | PROM2 prominin 2 [ Homo sapiens ] |
Official Symbol | PROM2 |
Synonyms | PROM2; prominin 2; prominin-2; hPROML2; prominin-like protein 2; prominin-related protein; PROML2; MGC138714; |
Gene ID | 150696 |
mRNA Refseq | NM_001165977 |
Protein Refseq | NP_001159449 |
UniProt ID | Q8N271 |
◆ Recombinant Proteins | ||
PROM2-8482Z | Recombinant Zebrafish PROM2 | +Inquiry |
PROM2-7135M | Recombinant Mouse PROM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PROM2-13436M | Recombinant Mouse PROM2 Protein | +Inquiry |
Prom2-5141M | Recombinant Mouse Prom2 Protein, Myc/DDK-tagged | +Inquiry |
PROM2-5733H | Recombinant Human PROM2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROM2-2833HCL | Recombinant Human PROM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROM2 Products
Required fields are marked with *
My Review for All PROM2 Products
Required fields are marked with *
0
Inquiry Basket