Recombinant Human PROM2 protein, His-SUMO-tagged
| Cat.No. : | PROM2-5733H |
| Product Overview : | Recombinant Human PROM2 protein(Q8N271)(27-106aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 27-106aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGY |
| Gene Name | PROM2 prominin 2 [ Homo sapiens ] |
| Official Symbol | PROM2 |
| Synonyms | PROM2; prominin 2; prominin-2; hPROML2; prominin-like protein 2; prominin-related protein; PROML2; MGC138714; |
| Gene ID | 150696 |
| mRNA Refseq | NM_001165977 |
| Protein Refseq | NP_001159449 |
| UniProt ID | Q8N271 |
| ◆ Recombinant Proteins | ||
| PROM2-13436M | Recombinant Mouse PROM2 Protein | +Inquiry |
| PROM2-8482Z | Recombinant Zebrafish PROM2 | +Inquiry |
| PROM2-4374R | Recombinant Rat PROM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PROM2-1806H | Recombinant Human PROM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PROM2-4715R | Recombinant Rat PROM2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PROM2-2833HCL | Recombinant Human PROM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROM2 Products
Required fields are marked with *
My Review for All PROM2 Products
Required fields are marked with *



