Recombinant Human PROM2 protein, His-SUMO-tagged

Cat.No. : PROM2-5733H
Product Overview : Recombinant Human PROM2 protein(Q8N271)(27-106aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 27-106aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 21.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGY
Gene Name PROM2 prominin 2 [ Homo sapiens ]
Official Symbol PROM2
Synonyms PROM2; prominin 2; prominin-2; hPROML2; prominin-like protein 2; prominin-related protein; PROML2; MGC138714;
Gene ID 150696
mRNA Refseq NM_001165977
Protein Refseq NP_001159449
UniProt ID Q8N271

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROM2 Products

Required fields are marked with *

My Review for All PROM2 Products

Required fields are marked with *

0
cart-icon