Recombinant Human proteasome 20S subunit alpha 1 Protein, His tagged

Cat.No. : PSMA1-001H
Product Overview : Recombinant Human PSMA1 Protein (16-263aa) with His tag was expressed in E. coli.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 16-263aa
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Tag : N-His
Molecular Mass : 29 kDa
AA Sequence : MHHHHHHHHQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH8.0
Concentration : 1 mg/mL by BCA
Gene Name PSMA1 proteasome 20S subunit alpha 1 [ Homo sapiens (human) ]
Official Symbol PSMA1
Synonyms PSMA1; proteasome (prosome, macropain) subunit, alpha type, 1; proteasome subunit alpha type-1; HC2; MGC1667; MGC14542; MGC14575; MGC14751; MGC21459; MGC22853; MGC23915; NU; PROS30; PROS-30; protein P30-33K; proteasome nu chain; macropain subunit C2; macropain subunit nu; proteasome subunit nu; 30 kDa prosomal protein; proteasome component C2; proteasome subunit, alpha-type, 1; multicatalytic endopeptidase complex subunit C2
Gene ID 5682
mRNA Refseq NM_001143937
Protein Refseq NP_001137409
MIM 602854
UniProt ID P25786

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMA1 Products

Required fields are marked with *

My Review for All PSMA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon