Recombinant Human proteasome 20S subunit alpha 1 Protein, His tagged
Cat.No. : | PSMA1-001H |
Product Overview : | Recombinant Human PSMA1 Protein (16-263aa) with His tag was expressed in E. coli. |
Availability | August 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 16-263aa |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Tag : | N-His |
Molecular Mass : | 29 kDa |
AA Sequence : | MHHHHHHHHQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH8.0 |
Concentration : | 1 mg/mL by BCA |
Gene Name | PSMA1 proteasome 20S subunit alpha 1 [ Homo sapiens (human) ] |
Official Symbol | PSMA1 |
Synonyms | PSMA1; proteasome (prosome, macropain) subunit, alpha type, 1; proteasome subunit alpha type-1; HC2; MGC1667; MGC14542; MGC14575; MGC14751; MGC21459; MGC22853; MGC23915; NU; PROS30; PROS-30; protein P30-33K; proteasome nu chain; macropain subunit C2; macropain subunit nu; proteasome subunit nu; 30 kDa prosomal protein; proteasome component C2; proteasome subunit, alpha-type, 1; multicatalytic endopeptidase complex subunit C2 |
Gene ID | 5682 |
mRNA Refseq | NM_001143937 |
Protein Refseq | NP_001137409 |
MIM | 602854 |
UniProt ID | P25786 |
◆ Recombinant Proteins | ||
PSMA1-839H | Recombinant Human PSMA1, T7-tagged | +Inquiry |
PSMA1-4421R | Recombinant Rat PSMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMA1-4762R | Recombinant Rat PSMA1 Protein | +Inquiry |
psmA1-4503S | Recombinant Staphylococcus aureus (strain NCTC 8325 / PS 47) psmA1 protein | +Inquiry |
PSMA1-560C | Recombinant Cynomolgus Monkey PSMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA1-2780HCL | Recombinant Human PSMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMA1 Products
Required fields are marked with *
My Review for All PSMA1 Products
Required fields are marked with *