Recombinant Human proteasome 20S subunit alpha 1 Protein, His tagged
| Cat.No. : | PSMA1-001H |
| Product Overview : | Recombinant Human PSMA1 Protein (16-263aa) with His tag was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 16-263aa |
| Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Tag : | N-His |
| Molecular Mass : | 29 kDa |
| AA Sequence : | MHHHHHHHHQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH8.0 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | PSMA1 proteasome 20S subunit alpha 1 [ Homo sapiens (human) ] |
| Official Symbol | PSMA1 |
| Synonyms | PSMA1; proteasome (prosome, macropain) subunit, alpha type, 1; proteasome subunit alpha type-1; HC2; MGC1667; MGC14542; MGC14575; MGC14751; MGC21459; MGC22853; MGC23915; NU; PROS30; PROS-30; protein P30-33K; proteasome nu chain; macropain subunit C2; macropain subunit nu; proteasome subunit nu; 30 kDa prosomal protein; proteasome component C2; proteasome subunit, alpha-type, 1; multicatalytic endopeptidase complex subunit C2 |
| Gene ID | 5682 |
| mRNA Refseq | NM_001143937 |
| Protein Refseq | NP_001137409 |
| MIM | 602854 |
| UniProt ID | P25786 |
| ◆ Recombinant Proteins | ||
| PSMA1-3465R | Recombinant Rhesus Macaque PSMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSMA1-3380H | Recombinant Human PSMA1 protein, His-tagged | +Inquiry |
| PSMA1-6577C | Recombinant Chicken PSMA1 | +Inquiry |
| PSMA1-3647R | Recombinant Rhesus monkey PSMA1 Protein, His-tagged | +Inquiry |
| PSMA1-30393TH | Recombinant Human PSMA1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMA1-2780HCL | Recombinant Human PSMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMA1 Products
Required fields are marked with *
My Review for All PSMA1 Products
Required fields are marked with *
