Recombinant Human PROX1 Protein, His-tagged

Cat.No. : PROX1-01H
Product Overview : Recombinant Human PROX1 Protein with a His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene is conserved across vertebrates and may play an essential role during development. Altered levels of this protein have been reported in cancers of different organs, such as colon, brain, blood, breast, pancreas, liver and esophagus. Alternative splicing results in multiple transcript variants.
Molecular Mass : 19.9 kDa
AA Sequence : QEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHEHHHHHH
Endotoxin : < 1 EU/μg
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/mL
Storage Buffer : PBS, pH 7.4.
Gene Name PROX1 prospero homeobox 1 [ Homo sapiens (human) ]
Official Symbol PROX1
Synonyms PROX1; prospero homeobox 1;
Gene ID 5629
mRNA Refseq NM_002763
Protein Refseq NP_002754
MIM 601546
UniProt ID Q92786

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROX1 Products

Required fields are marked with *

My Review for All PROX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon