Recombinant Human PROX1 Protein, His-tagged
Cat.No. : | PROX1-01H |
Product Overview : | Recombinant Human PROX1 Protein with a His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene is conserved across vertebrates and may play an essential role during development. Altered levels of this protein have been reported in cancers of different organs, such as colon, brain, blood, breast, pancreas, liver and esophagus. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 19.9 kDa |
AA Sequence : | QEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHEHHHHHH |
Endotoxin : | < 1 EU/μg |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/mL |
Storage Buffer : | PBS, pH 7.4. |
Gene Name | PROX1 prospero homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | PROX1 |
Synonyms | PROX1; prospero homeobox 1; |
Gene ID | 5629 |
mRNA Refseq | NM_002763 |
Protein Refseq | NP_002754 |
MIM | 601546 |
UniProt ID | Q92786 |
◆ Recombinant Proteins | ||
PROX1-13443M | Recombinant Mouse PROX1 Protein | +Inquiry |
PROX1-30591TH | Recombinant Human PROX1 | +Inquiry |
PROX1-01H | Recombinant Human PROX1 Protein, His-tagged | +Inquiry |
PROX1-3621R | Recombinant Rhesus monkey PROX1 Protein, His-tagged | +Inquiry |
PROX1-3439R | Recombinant Rhesus Macaque PROX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROX1-2830HCL | Recombinant Human PROX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROX1 Products
Required fields are marked with *
My Review for All PROX1 Products
Required fields are marked with *