Recombinant Human PRPH

Cat.No. : PRPH-30643TH
Product Overview : Recombinant fragment corresponding to amino acids 374-470 of Human Peripherin with an N terminal proprietary tag; Predicted MWt 36.3 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 97 amino acids
Description : This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis.
Molecular Weight : 36.300kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Sequence Similarities : Belongs to the intermediate filament family.
Gene Name PRPH peripherin [ Homo sapiens ]
Official Symbol PRPH
Synonyms PRPH; peripherin; NEF4; PRPH1;
Gene ID 5630
mRNA Refseq NM_006262
Protein Refseq NP_006253
MIM 170710
Uniprot ID P41219
Chromosome Location 12q12-q13
Pathway Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRPH Products

Required fields are marked with *

My Review for All PRPH Products

Required fields are marked with *

0
cart-icon
0
compare icon