Recombinant Human PRPH

• Cat.No.: PRPH-30643TH
• Product Overview: Recombinant fragment corresponding to amino acids 374-470 of Human Peripherin with an N terminal proprietary tag; Predicted MWt 36.3 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 97 amino acids
• Description: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis.
• Molecular Weight: 36.300kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
• Sequence Similarities: Belongs to the intermediate filament family.

Gene Information

• Gene Name: PRPH peripherin [ Homo sapiens ]
• Official Symbol: PRPH
• Synonyms: PRPH; peripherin; NEF4; PRPH1
• Gene ID: 5630
• mRNA Refseq: NM_006262
• Protein Refseq: NP_006253
• MIM: 170710
• Uniprot ID: P41219
• Chromosome Location: 12q12-q13
• Pathway: Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem
• Function: structural molecule activity