Recombinant Human PRPS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRPS1-5047H |
Product Overview : | PRPS1 MS Standard C13 and N15-labeled recombinant protein (NP_002755) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRPS1 phosphoribosyl pyrophosphate synthetase 1 [ Homo sapiens (human) ] |
Official Symbol | PRPS1 |
Synonyms | PRPS1; phosphoribosyl pyrophosphate synthetase 1; deafness, X linked 2, perceptive, congenital, DFN2; ribose-phosphate pyrophosphokinase 1; CMTX5; DFNX1; PRS I; ribose phosphate diphosphokinase 1; deafness 2, perceptive, congenital; ribose-phosphate diphosphokinase 1; phosphoribosyl pyrophosphate synthase I; deafness, X-linked 2, perceptive, congenital; dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1); ARTS; DFN2; PRSI; PRS-I; PPRibP; KIAA0967; |
Gene ID | 5631 |
mRNA Refseq | NM_002764 |
Protein Refseq | NP_002755 |
MIM | 311850 |
UniProt ID | P60891 |
◆ Recombinant Proteins | ||
PRPS1-4723R | Recombinant Rat PRPS1 Protein | +Inquiry |
PRPS1-3372H | Recombinant Human PRPS1 protein, His-SUMO-tagged | +Inquiry |
PRPS1-3444R | Recombinant Rhesus Macaque PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRPS1-5047H | Recombinant Human PRPS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRPS1-7150M | Recombinant Mouse PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPS1-2820HCL | Recombinant Human PRPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPS1 Products
Required fields are marked with *
My Review for All PRPS1 Products
Required fields are marked with *
0
Inquiry Basket