Recombinant Human PRPS1
| Cat.No. : | PRPS1-30999TH |
| Product Overview : | Recombinant full length Human PRPS1, expressed in Saccharomyces cerevisiae. 318 aas. MW 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Description : | This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Store at -20°C. Stable for 12 months at -20°C |
| Sequences of amino acids : | MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQET CVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACK IASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSV AGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIR ENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKER KKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAAD KLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYL FSHVPL |
| Sequence Similarities : | Belongs to the ribose-phosphate pyrophosphokinase family. |
| Full Length : | Full L. |
| Gene Name | PRPS1 phosphoribosyl pyrophosphate synthetase 1 [ Homo sapiens ] |
| Official Symbol | PRPS1 |
| Synonyms | PRPS1; phosphoribosyl pyrophosphate synthetase 1; deafness, X linked 2, perceptive, congenital , DFN2; ribose-phosphate pyrophosphokinase 1; CMTX5; DFNX1; PRS I; ribose phosphate diphosphokinase 1; |
| Gene ID | 5631 |
| mRNA Refseq | NM_001204402 |
| Protein Refseq | NP_001191331 |
| MIM | 311850 |
| Uniprot ID | P60891 |
| Chromosome Location | Xq21-q27 |
| Pathway | 5-Phosphoribose 1-diphosphate biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; PRPP biosynthesis, ribose 5P => |
| Function | ATP binding; kinase activity; magnesium ion binding; nucleotide binding; protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| PRPS1-7150M | Recombinant Mouse PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRPS1-494H | Recombinant Human PRPS1, His-tagged | +Inquiry |
| PRPS1-3372H | Recombinant Human PRPS1 protein, His-SUMO-tagged | +Inquiry |
| PRPS1-4382R | Recombinant Rat PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRPS1-557C | Recombinant Cynomolgus Monkey PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRPS1-2820HCL | Recombinant Human PRPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRPS1 Products
Required fields are marked with *
My Review for All PRPS1 Products
Required fields are marked with *
