Recombinant Human PRSS12 Protein (631-874 aa), His-SUMO-tagged
Cat.No. : | PRSS12-1893H |
Product Overview : | Recombinant Human PRSS12 Protein (631-874 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 631-874 aa |
Description : | Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.4 kDa |
AA Sequence : | IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PRSS12 protease, serine, 12 (neurotrypsin, motopsin) [ Homo sapiens ] |
Official Symbol | PRSS12 |
Synonyms | PRSS12; neurotrypsin; BSSP 3; MRT1; leydin; BSSP3; BSSP-3; MGC12722; |
Gene ID | 8492 |
mRNA Refseq | NM_003619 |
Protein Refseq | NP_003610 |
MIM | 606709 |
UniProt ID | P56730 |
◆ Recombinant Proteins | ||
PRSS12-7167M | Recombinant Mouse PRSS12 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRSS12-3636R | Recombinant Rhesus monkey PRSS12 Protein, His-tagged | +Inquiry |
Prss12-6907M | Recombinant Mouse Prss12 protein, His & T7-tagged | +Inquiry |
PRSS12-13496M | Recombinant Mouse PRSS12 Protein | +Inquiry |
PRSS12-1893H | Recombinant Human PRSS12 Protein (631-874 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS12-1422HCL | Recombinant Human PRSS12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS12 Products
Required fields are marked with *
My Review for All PRSS12 Products
Required fields are marked with *