Recombinant Human PRSS12 Protein (631-874 aa), His-SUMO-tagged

• Cat.No.: PRSS12-1893H
• Product Overview: Recombinant Human PRSS12 Protein (631-874 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 631-874 aa
• Description: Plays a role in neuronal plasticity and the proteolytic action may subserve structural reorganizations associated with learning and memory operations.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 43.4 kDa
• AA Sequence: IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: PRSS12 protease, serine, 12 (neurotrypsin, motopsin) [ Homo sapiens ]
• Official Symbol: PRSS12
• Synonyms: PRSS12; neurotrypsin; BSSP 3; MRT1; leydin; BSSP3; BSSP-3; MGC12722
• Gene ID: 8492
• mRNA Refseq: NM_003619
• Protein Refseq: NP_003610
• MIM: 606709
• UniProt ID: P56730