Recombinant Human PRSS2 protein(16-247aa(K23Q,S167G)), His-tagged

• Cat.No.: PRSS2-3029H
• Product Overview: Recombinant Human PRSS2 protein(P07478)(16-247aa(K23Q,S167G)), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 16-247aa(K23Q,S167G)
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.9 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Gene Information

• Gene Name: PRSS2 protease, serine, 2 (trypsin 2) [ Homo sapiens ]
• Official Symbol: PRSS2
• Synonyms: PRSS2; protease, serine, 2 (trypsin 2); trypsin-2; TRY2; trypsin 2; trypsin II; trypsinogen 2; serine protease 2; anionic trypsinogen; protease serine 2 preproprotein; protease, serine, 2, preproprotein; TRY8; TRYP2; MGC111183; MGC120174; MGC120175
• Gene ID: 5645
• mRNA Refseq: NM_002770
• Protein Refseq: NP_002761
• MIM: 601564
• UniProt ID: P07478