Recombinant Human PRSS2 protein(16-247aa(K23Q,S167G)), His-tagged

Cat.No. : PRSS2-3029H
Product Overview : Recombinant Human PRSS2 protein(P07478)(16-247aa(K23Q,S167G)), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 16-247aa(K23Q,S167G)
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.9 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Gene Name PRSS2 protease, serine, 2 (trypsin 2) [ Homo sapiens ]
Official Symbol PRSS2
Synonyms PRSS2; protease, serine, 2 (trypsin 2); trypsin-2; TRY2; trypsin 2; trypsin II; trypsinogen 2; serine protease 2; anionic trypsinogen; protease serine 2 preproprotein; protease, serine, 2, preproprotein; TRY8; TRYP2; MGC111183; MGC120174; MGC120175;
Gene ID 5645
mRNA Refseq NM_002770
Protein Refseq NP_002761
MIM 601564
UniProt ID P07478

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS2 Products

Required fields are marked with *

My Review for All PRSS2 Products

Required fields are marked with *

0
cart-icon