Recombinant Human PRUNE Protein (1-168 aa), His-tagged
Cat.No. : | PRUNE-1055H |
Product Overview : | Recombinant Human PRUNE Protein (1-168 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Isoform 6. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-168 aa |
Description : | Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MLRKDQKTIYRQGVKVAISAIYMDLEICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | PRUNE prune homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | PRUNE |
Synonyms | PRUNE; DRES 17; HTCD37; DRES17; DRES-17; |
Gene ID | 58497 |
mRNA Refseq | NM_021222 |
Protein Refseq | NP_067045 |
UniProt ID | Q86TP1 |
◆ Recombinant Proteins | ||
PRUNE-1997H | Recombinant Human PRUNE, His-tagged | +Inquiry |
PRUNE-7194M | Recombinant Mouse PRUNE Protein, His (Fc)-Avi-tagged | +Inquiry |
PRUNE-13535M | Recombinant Mouse PRUNE Protein | +Inquiry |
PRUNE-4413R | Recombinant Rat PRUNE Protein, His (Fc)-Avi-tagged | +Inquiry |
PRUNE-4754R | Recombinant Rat PRUNE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRUNE-2796HCL | Recombinant Human PRUNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRUNE Products
Required fields are marked with *
My Review for All PRUNE Products
Required fields are marked with *