Recombinant Human PRUNE Protein (1-168 aa), His-tagged

• Cat.No.: PRUNE-1055H
• Product Overview: Recombinant Human PRUNE Protein (1-168 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Isoform 6.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-168 aa
• Description: Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 22.5 kDa
• AA Sequence: MLRKDQKTIYRQGVKVAISAIYMDLEICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: PRUNE prune homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: PRUNE
• Synonyms: PRUNE; DRES 17; HTCD37; DRES17; DRES-17
• Gene ID: 58497
• mRNA Refseq: NM_021222
• Protein Refseq: NP_067045
• UniProt ID: Q86TP1