Recombinant Human PSAP protein, GST-tagged

• Cat.No.: PSAP-257H
• Product Overview: Recombinant Human PSAP(1 a.a. - 524 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-524 a.a.
• Description: This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 83.16 kDa
• AA Sequence: MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVVTAAGD MLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNH QKQLESNKIPELDITEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEH VKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVE PIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEE VSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQ CDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPLAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PSAP prosaposin [ Homo sapiens ]
• Official Symbol: PSAP
• Synonyms: PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993
• Gene ID: 5660
• mRNA Refseq: NM_002778
• Protein Refseq: NP_002769
• MIM: 176801
• UniProt ID: P07602
• Chromosome Location: 10q21-q22
• Pathway: Glycosphingolipid metabolism, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem
• Function: enzyme activator activity; lipid binding