Recombinant Human PSAP protein, GST-tagged
| Cat.No. : | PSAP-189H |
| Product Overview : | Recombinant Human PSAP protein(NP_001035930)(406-487 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 406-487 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | GGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PSAP prosaposin [ Homo sapiens ] |
| Official Symbol | PSAP |
| Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993; |
| Gene ID | 5660 |
| mRNA Refseq | NM_001042465 |
| Protein Refseq | NP_001035930 |
| MIM | 176801 |
| UniProt ID | P07602 |
| ◆ Recombinant Proteins | ||
| PSAP-21H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
| PSAP-9387Z | Recombinant Zebrafish PSAP | +Inquiry |
| PSAP-611HF | Recombinant Full Length Human PSAP Protein, GST-tagged | +Inquiry |
| Psap-1013M | Recombinant Mouse Psap Protein, His-tagged | +Inquiry |
| PSAP-6022H | Recombinant Human PSAP Protein (Gly17-Asn524), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
| PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *



