Recombinant Human PSAP protein, GST-tagged
| Cat.No. : | PSAP-3377H |
| Product Overview : | Recombinant Human PSAP protein(P07602)(311-391aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 311-391aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PSAP prosaposin [ Homo sapiens ] |
| Official Symbol | PSAP |
| Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993; |
| Gene ID | 5660 |
| mRNA Refseq | NM_001042465 |
| Protein Refseq | NP_001035930 |
| MIM | 176801 |
| UniProt ID | P07602 |
| ◆ Recombinant Proteins | ||
| PSAP-20H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
| PSAP-5504H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
| PSAP-9387Z | Recombinant Zebrafish PSAP | +Inquiry |
| PSAP-6374C | Recombinant Chicken PSAP | +Inquiry |
| PSAP-7197M | Recombinant Mouse PSAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
| PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *



