Recombinant Human PSMA5
| Cat.No. : | PSMA5-29976TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 132-241 of Human Proteasome 20S alpha 5 with a N terminal proprietary tag, predicted MW: 37.73 kDa inclusive of tag. P28066, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Expressed in fetal brain (at protein level). |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIG SASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLN ATNIELATVQPGQNFHMFTKEELEEVIKDI |
| Sequence Similarities : | Belongs to the peptidase T1A family. |
| Gene Name | PSMA5 proteasome (prosome, macropain) subunit, alpha type, 5 [ Homo sapiens ] |
| Official Symbol | PSMA5 |
| Synonyms | PSMA5; proteasome (prosome, macropain) subunit, alpha type, 5; proteasome subunit alpha type-5; ZETA; |
| Gene ID | 5686 |
| mRNA Refseq | NM_001199772 |
| Protein Refseq | NP_001186701 |
| MIM | 176844 |
| Uniprot ID | P28066 |
| Chromosome Location | 1p13 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
| Function | peptidase activity; protein binding; threonine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| PSMA5-3058H | Recombinant Human PSMA5 Protein, MYC/DDK-tagged | +Inquiry |
| PSMA5-29976TH | Recombinant Human PSMA5 | +Inquiry |
| Psma5-5175M | Recombinant Mouse Psma5 Protein, Myc/DDK-tagged | +Inquiry |
| PSMA5-414H | Recombinant Human PSMA5 Protein, His-tagged | +Inquiry |
| PSMA5-3651R | Recombinant Rhesus monkey PSMA5 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMA5 Products
Required fields are marked with *
My Review for All PSMA5 Products
Required fields are marked with *
