Recombinant Human PSMA5

Cat.No. : PSMA5-29976TH
Product Overview : Recombinant fragment corresponding to amino acids 132-241 of Human Proteasome 20S alpha 5 with a N terminal proprietary tag, predicted MW: 37.73 kDa inclusive of tag. P28066,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Expressed in fetal brain (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIG SASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLN ATNIELATVQPGQNFHMFTKEELEEVIKDI
Sequence Similarities : Belongs to the peptidase T1A family.
Gene Name PSMA5 proteasome (prosome, macropain) subunit, alpha type, 5 [ Homo sapiens ]
Official Symbol PSMA5
Synonyms PSMA5; proteasome (prosome, macropain) subunit, alpha type, 5; proteasome subunit alpha type-5; ZETA;
Gene ID 5686
mRNA Refseq NM_001199772
Protein Refseq NP_001186701
MIM 176844
Uniprot ID P28066
Chromosome Location 1p13
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; protein binding; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMA5 Products

Required fields are marked with *

My Review for All PSMA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon