Recombinant Human PSMB3 protein, GST-tagged

Cat.No. : PSMB3-3381H
Product Overview : Recombinant Human PSMB3 protein(P49720)(1-205aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-205aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 49.8 kDa
AA Sequence : SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PSMB3 proteasome (prosome, macropain) subunit, beta type, 3 [ Homo sapiens ]
Official Symbol PSMB3
Synonyms PSMB3; proteasome (prosome, macropain) subunit, beta type, 3; proteasome subunit beta type-3; HC10 II; MGC4147; proteasome chain 13; proteasome theta chain; proteasome component C10-II; HC10-II;
Gene ID 5691
mRNA Refseq NM_002795
Protein Refseq NP_002786
MIM 602176
UniProt ID P49720

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB3 Products

Required fields are marked with *

My Review for All PSMB3 Products

Required fields are marked with *

0
cart-icon