Recombinant Human PSMB3 protein, GST-tagged
Cat.No. : | PSMB3-3381H |
Product Overview : | Recombinant Human PSMB3 protein(P49720)(1-205aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-205aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PSMB3 proteasome (prosome, macropain) subunit, beta type, 3 [ Homo sapiens ] |
Official Symbol | PSMB3 |
Synonyms | PSMB3; proteasome (prosome, macropain) subunit, beta type, 3; proteasome subunit beta type-3; HC10 II; MGC4147; proteasome chain 13; proteasome theta chain; proteasome component C10-II; HC10-II; |
Gene ID | 5691 |
mRNA Refseq | NM_002795 |
Protein Refseq | NP_002786 |
MIM | 602176 |
UniProt ID | P49720 |
◆ Recombinant Proteins | ||
PSMB3-4431R | Recombinant Rat PSMB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB3-7060Z | Recombinant Zebrafish PSMB3 | +Inquiry |
PSMB3-1540H | Recombinant Human Proteasome (Prosome, Macropain) Subunit, Beta Type, 3, His-tagged | +Inquiry |
PSMB3-2017H | Recombinant Human PSMB3, His-tagged | +Inquiry |
PSMB3-3657R | Recombinant Rhesus monkey PSMB3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB3-2773HCL | Recombinant Human PSMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMB3 Products
Required fields are marked with *
My Review for All PSMB3 Products
Required fields are marked with *