Recombinant Human PSMB6, His-tagged
Cat.No. : | PSMB6-29975TH |
Product Overview : | Recombinant full length Human Proteasome 20S beta 6 with N terminal His tag; 226 amino acids with tag, Predicted MWt 24.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 205 amino acids |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 1i (proteasome beta 9 subunit). |
Conjugation : | HIS |
Molecular Weight : | 24.200kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTTIMAVQFDGGVVLGADSR TTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAV TYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGII IAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYV DATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI AESGVERQVLLGDQIPKFAVATLPPA |
Sequence Similarities : | Belongs to the peptidase T1B family. |
Gene Name | PSMB6 proteasome (prosome, macropain) subunit, beta type, 6 [ Homo sapiens ] |
Official Symbol | PSMB6 |
Synonyms | PSMB6; proteasome (prosome, macropain) subunit, beta type, 6; proteasome subunit beta type-6; DELTA; Y; |
Gene ID | 5694 |
mRNA Refseq | NM_002798 |
Protein Refseq | NP_002789 |
MIM | 600307 |
Uniprot ID | P28072 |
Chromosome Location | 17p13 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | endopeptidase activity; peptidase activity; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PSMB6-4433R | Recombinant Rat PSMB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB6-29975TH | Recombinant Human PSMB6, His-tagged | +Inquiry |
PSMB6-3478R | Recombinant Rhesus Macaque PSMB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB6-3660R | Recombinant Rhesus monkey PSMB6 Protein, His-tagged | +Inquiry |
PSMB6-7569H | Recombinant Human PSMB6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB6-2770HCL | Recombinant Human PSMB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMB6 Products
Required fields are marked with *
My Review for All PSMB6 Products
Required fields are marked with *