Recombinant Human PSMB6, His-tagged

Cat.No. : PSMB6-29975TH
Product Overview : Recombinant full length Human Proteasome 20S beta 6 with N terminal His tag; 226 amino acids with tag, Predicted MWt 24.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 205 amino acids
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 1i (proteasome beta 9 subunit).
Conjugation : HIS
Molecular Weight : 24.200kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMTTIMAVQFDGGVVLGADSR TTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAV TYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGII IAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYV DATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI AESGVERQVLLGDQIPKFAVATLPPA
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name PSMB6 proteasome (prosome, macropain) subunit, beta type, 6 [ Homo sapiens ]
Official Symbol PSMB6
Synonyms PSMB6; proteasome (prosome, macropain) subunit, beta type, 6; proteasome subunit beta type-6; DELTA; Y;
Gene ID 5694
mRNA Refseq NM_002798
Protein Refseq NP_002789
MIM 600307
Uniprot ID P28072
Chromosome Location 17p13
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function endopeptidase activity; peptidase activity; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB6 Products

Required fields are marked with *

My Review for All PSMB6 Products

Required fields are marked with *

0
cart-icon
0
compare icon