"PSMB7" Related Products

Expand
Expand

Recombinant Human PSMB7 protein, T7-tagged

Cat.No.: PSMB7-161H
Product Overview: Recombinant human PSMB7 (277 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQG YIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Purity: >90% by SDS-PAGE
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: PSMB7 proteasome (prosome, macropain) subunit, beta type, 7 [ Homo sapiens ]
Official Symbol: PSMB7
Synonyms: PSMB7; macropain chain Z; proteasome subunit Z; proteasome subunit alpha; proteasome subunit beta 7;
Gene ID: 5695
mRNA Refseq: NM_002799
Protein Refseq: NP_002790
MIM: 604030
UniProt ID: Q99436
Chromosome Location: 9q34.11-q34.12
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem;
Function: peptidase activity; protein binding; threonine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.