Recombinant Human PSMB8 protein(181-270 aa), C-His-tagged

Cat.No. : PSMB8-2708H
Product Overview : Recombinant Human PSMB8 protein(P28062)(181-270 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 181-270 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQ
Gene Name PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) [ Homo sapiens ]
Official Symbol PSMB8
Synonyms PSMB8; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); LMP7, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7); proteasome subunit beta type-8; beta5i; D6S216E; PSMB5i; RING10; macropain subunit C13; proteasome subunit Y2; protease component C13; proteasome component C13; proteasome-related gene 7; proteasome subunit beta 5i; low molecular mass protein 7; low molecular weight protein 7; proteasome catalytic subunit 3i; really interesting new gene 10 protein; multicatalytic endopeptidase complex subunit C13; JMP; ALDD; LMP7; NKJO; D6S216; MGC1491;
Gene ID 5696
mRNA Refseq NM_004159
Protein Refseq NP_004150
MIM 177046
UniProt ID P28062

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB8 Products

Required fields are marked with *

My Review for All PSMB8 Products

Required fields are marked with *

0
cart-icon
0
compare icon