Recombinant Human PSMB8 protein, His-SUMO & Myc-tagged

Cat.No. : PSMB8-3382H
Product Overview : Recombinant Human PSMB8 protein(P28062)(73-276aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 73-276aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.7 kDa
AA Sequence : TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) [ Homo sapiens ]
Official Symbol PSMB8
Synonyms PSMB8; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); LMP7, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7); proteasome subunit beta type-8; beta5i; D6S216E; PSMB5i; RING10; macropain subunit C13; proteasome subunit Y2; protease component C13; proteasome component C13; proteasome-related gene 7; proteasome subunit beta 5i; low molecular mass protein 7; low molecular weight protein 7; proteasome catalytic subunit 3i; really interesting new gene 10 protein; multicatalytic endopeptidase complex subunit C13; JMP; ALDD; LMP7; NKJO; D6S216; MGC1491;
Gene ID 5696
mRNA Refseq NM_004159
Protein Refseq NP_004150
MIM 177046
UniProt ID P28062

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB8 Products

Required fields are marked with *

My Review for All PSMB8 Products

Required fields are marked with *

0
cart-icon