Recombinant Human PSMB8 protein, His-SUMO & Myc-tagged
Cat.No. : | PSMB8-3382H |
Product Overview : | Recombinant Human PSMB8 protein(P28062)(73-276aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 73-276aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.7 kDa |
AA Sequence : | TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) [ Homo sapiens ] |
Official Symbol | PSMB8 |
Synonyms | PSMB8; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); LMP7, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7); proteasome subunit beta type-8; beta5i; D6S216E; PSMB5i; RING10; macropain subunit C13; proteasome subunit Y2; protease component C13; proteasome component C13; proteasome-related gene 7; proteasome subunit beta 5i; low molecular mass protein 7; low molecular weight protein 7; proteasome catalytic subunit 3i; really interesting new gene 10 protein; multicatalytic endopeptidase complex subunit C13; JMP; ALDD; LMP7; NKJO; D6S216; MGC1491; |
Gene ID | 5696 |
mRNA Refseq | NM_004159 |
Protein Refseq | NP_004150 |
MIM | 177046 |
UniProt ID | P28062 |
◆ Recombinant Proteins | ||
Psmb8-1330M | Recombinant Mouse Psmb8 Protein, MYC/DDK-tagged | +Inquiry |
PSMB8-7214M | Recombinant Mouse PSMB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB8-4435R | Recombinant Rat PSMB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Psmb8-7117R | Recombinant Rat Psmb8 protein, His & T7-tagged | +Inquiry |
PSMB8-8966Z | Recombinant Zebrafish PSMB8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB8-2767HCL | Recombinant Human PSMB8 293 Cell Lysate | +Inquiry |
PSMB8-2768HCL | Recombinant Human PSMB8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMB8 Products
Required fields are marked with *
My Review for All PSMB8 Products
Required fields are marked with *