Recombinant Human PSMC3
| Cat.No. : | PSMC3-31224TH |
| Product Overview : | Recombinant fragment of Human PSMC3 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases that have chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD |
| Sequence Similarities : | Belongs to the AAA ATPase family. |
| Gene Name | PSMC3 proteasome (prosome, macropain) 26S subunit, ATPase, 3 [ Homo sapiens ] |
| Official Symbol | PSMC3 |
| Synonyms | PSMC3; proteasome (prosome, macropain) 26S subunit, ATPase, 3; 26S protease regulatory subunit 6A; TBP 1; TBP1; |
| Gene ID | 5702 |
| mRNA Refseq | NM_002804 |
| Protein Refseq | NP_002795 |
| MIM | 186852 |
| Uniprot ID | P17980 |
| Chromosome Location | 11p11.2 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
| Function | ATP binding; hydrolase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| PSMC3-2854C | Recombinant Chicken PSMC3 | +Inquiry |
| PSMC3-4780R | Recombinant Rat PSMC3 Protein | +Inquiry |
| PSMC3-3482R | Recombinant Rhesus Macaque PSMC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSMC3-4439R | Recombinant Rat PSMC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSMC3-3976H | Recombinant Human PSMC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMC3-2763HCL | Recombinant Human PSMC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMC3 Products
Required fields are marked with *
My Review for All PSMC3 Products
Required fields are marked with *
