Recombinant Human PSMD1, GST-tagged
| Cat.No. : | PSMD1-2026H |
| Product Overview : | Recombinant Human PSMD1(1 a.a. - 110 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes the largest non-ATPase subunit of the 19S regulator lid, which is responsible for substrate recognition and binding. Alternatively spliced transcript variants have been found for this gene. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFE ESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTK |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PSMD1 proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 [ Homo sapiens ] |
| Official Symbol | PSMD1 |
| Synonyms | PSMD1; proteasome (prosome, macropain) 26S subunit, non-ATPase, 1; 26S proteasome non-ATPase regulatory subunit 1; P112; Rpn2; S1; 26S proteasome subunit p112; 26S proteasome regulatory subunit S1; 26S proteasome regulatory subunit RPN2; MGC133040; MGC133041 |
| Gene ID | 5707 |
| mRNA Refseq | NM_002807 |
| Protein Refseq | NP_002798 |
| UniProt ID | Q99460 |
| Chromosome Location | 2q37.1 |
| Pathway | AMER1 mutants destabilize the destruction complex; APC/C:Cdc20 mediated degradation of Securin; AXIN missense mutants destabilize the destruction complex |
| Function | enzyme regulator activity |
| ◆ Recombinant Proteins | ||
| PSMD1-2026H | Recombinant Human PSMD1, GST-tagged | +Inquiry |
| PSMD1-4443R | Recombinant Rat PSMD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSMD1-3485R | Recombinant Rhesus Macaque PSMD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSMD1-3667R | Recombinant Rhesus monkey PSMD1 Protein, His-tagged | +Inquiry |
| PSMD1-13587M | Recombinant Mouse PSMD1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMD1-2757HCL | Recombinant Human PSMD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMD1 Products
Required fields are marked with *
My Review for All PSMD1 Products
Required fields are marked with *
