Recombinant Human PSMD1, GST-tagged
Cat.No. : | PSMD1-2026H |
Product Overview : | Recombinant Human PSMD1(1 a.a. - 110 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes the largest non-ATPase subunit of the 19S regulator lid, which is responsible for substrate recognition and binding. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFE ESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTK |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PSMD1 proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 [ Homo sapiens ] |
Official Symbol | PSMD1 |
Synonyms | PSMD1; proteasome (prosome, macropain) 26S subunit, non-ATPase, 1; 26S proteasome non-ATPase regulatory subunit 1; P112; Rpn2; S1; 26S proteasome subunit p112; 26S proteasome regulatory subunit S1; 26S proteasome regulatory subunit RPN2; MGC133040; MGC133041 |
Gene ID | 5707 |
mRNA Refseq | NM_002807 |
Protein Refseq | NP_002798 |
UniProt ID | Q99460 |
Chromosome Location | 2q37.1 |
Pathway | AMER1 mutants destabilize the destruction complex; APC/C:Cdc20 mediated degradation of Securin; AXIN missense mutants destabilize the destruction complex |
Function | enzyme regulator activity |
◆ Recombinant Proteins | ||
PSMD1-2026H | Recombinant Human PSMD1, GST-tagged | +Inquiry |
PSMD1-1970C | Recombinant Chicken PSMD1 | +Inquiry |
PSMD1-11401Z | Recombinant Zebrafish PSMD1 | +Inquiry |
PSMD1-2025H | Recombinant Human PSMD1, GST-tagged | +Inquiry |
PSMD1-3667R | Recombinant Rhesus monkey PSMD1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD1-2757HCL | Recombinant Human PSMD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMD1 Products
Required fields are marked with *
My Review for All PSMD1 Products
Required fields are marked with *
0
Inquiry Basket