Recombinant Human PSMD4, His-tagged
Cat.No. : | PSMD4-183H |
Product Overview : | Recombinant Human 26S Proteasome Non-ATPase Regulatory Subunit 4/PSMD4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val2-Lys377) of Human PSMD4 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 2-377 a.a. |
Description : | 26S Proteasome Non-ATPase Regulatory Subunit 4 (PSMD4) belongs to the proteasome subunit S5A family. Proteasomes are widely distributed in eukaryotic cells at a high concentrations and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. PSMD4 contains two UIM (ubiquitin-interacting motif) repeats and one VWFA domain. PSMD4 is composed of a core protease, known as the 20S proteasome, capped at one or both ends by the 19S regulatory complex (RC). PSMD4 binds and presumably selects ubiquitin-conjugates for destruction, displaying selectivity for longer polyubiquitin chains. PSMD4 also modulates intestinal fluid secretion. |
AA Sequence : | MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLT PDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKR LKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGA MLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDAL LKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDD YDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | PSMD4 proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [ Homo sapiens ] |
Official Symbol | PSMD4 |
Synonyms | PSMD4; proteasome (prosome, macropain) 26S subunit, non-ATPase, 4; 26S proteasome non-ATPase regulatory subunit 4; AF; AF 1; Rpn10; S5A; angiocidin; RPN10 homolog; antisecretory factor 1; S5a/antisecretory factor protein; multiubiquitin chain-binding protein; 26S proteasome regulatory subunit S5A; ASF; AF-1; MCB1; pUB-R5; |
Gene ID | 5710 |
mRNA Refseq | NM_002810 |
Protein Refseq | NP_002801 |
MIM | 601648 |
UniProt ID | P55036 |
Chromosome Location | 1q21.2 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
PSMD4-13595M | Recombinant Mouse PSMD4 Protein | +Inquiry |
PSMD4-3892C | Recombinant Chicken PSMD4 | +Inquiry |
PSMD4-548H | Recombinant Human PSMD4 | +Inquiry |
PSMD4-422H | Recombinant Human PSMD4 Protein, His/GST-tagged | +Inquiry |
PSMD4-1246H | Recombinant Human PSMD4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD4-2748HCL | Recombinant Human PSMD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMD4 Products
Required fields are marked with *
My Review for All PSMD4 Products
Required fields are marked with *