Recombinant Human PSMD9, His-tagged
Cat.No. : | PSMD9-26023TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-223 of Human 26S Proteasome with N terminal His tag, 29kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-223 a.a. |
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKAN YDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHN IICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAH KEAMSRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQ VDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIR RGEKHQLRLVPTRWAGKGLLGCNIIPLQR |
Full Length : | Full L. |
Gene Name | PSMD9 proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 [ Homo sapiens ] |
Official Symbol | PSMD9 |
Synonyms | PSMD9; proteasome (prosome, macropain) 26S subunit, non-ATPase, 9; 26S proteasome non-ATPase regulatory subunit 9; p27; Rpn4; |
Gene ID | 5715 |
mRNA Refseq | NM_002813 |
Protein Refseq | NP_002804 |
MIM | 603146 |
Uniprot ID | O00233 |
Chromosome Location | 12q24.31-q24.32 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | bHLH transcription factor binding; protein binding; transcription coactivator activity; |
◆ Recombinant Proteins | ||
PSMD9-569Z | Recombinant Zebrafish PSMD9 | +Inquiry |
PSMD9-4788R | Recombinant Rat PSMD9 Protein | +Inquiry |
PSMD9-365H | Recombinant Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, His-tagged | +Inquiry |
PSMD9-26023TH | Recombinant Human PSMD9, His-tagged | +Inquiry |
PSMD9-7226M | Recombinant Mouse PSMD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD9-2743HCL | Recombinant Human PSMD9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMD9 Products
Required fields are marked with *
My Review for All PSMD9 Products
Required fields are marked with *
0
Inquiry Basket