Recombinant Human PSME3 protein, GST-tagged
| Cat.No. : | PSME3-3384H |
| Product Overview : | Recombinant Human PSME3 protein(P61289)(2-252aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-252aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.1 kDa |
| AA Sequence : | ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PSME3 proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) [ Homo sapiens ] |
| Official Symbol | PSME3 |
| Synonyms | PSME3; proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki); proteasome activator complex subunit 3; Ki; PA28 gamma; PA28G; REG GAMMA; PA28gamma; Ki antigen; Ki nuclear autoantigen; proteasome activator 28-gamma; 11S regulator complex gamma subunit; 11S regulator complex subunit gamma; proteasome activator 28 subunit gamma; activator of multicatalytic protease subunit 3; REG-GAMMA; PA28-gamma; |
| Gene ID | 10197 |
| mRNA Refseq | NM_005789 |
| Protein Refseq | NP_005780 |
| MIM | 605129 |
| UniProt ID | P61289 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSME3 Products
Required fields are marked with *
My Review for All PSME3 Products
Required fields are marked with *



