Recombinant Human PSME3 protein, GST-tagged

Cat.No. : PSME3-3384H
Product Overview : Recombinant Human PSME3 protein(P61289)(2-252aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-252aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 56.1 kDa
AA Sequence : ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PSME3 proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) [ Homo sapiens ]
Official Symbol PSME3
Synonyms PSME3; proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki); proteasome activator complex subunit 3; Ki; PA28 gamma; PA28G; REG GAMMA; PA28gamma; Ki antigen; Ki nuclear autoantigen; proteasome activator 28-gamma; 11S regulator complex gamma subunit; 11S regulator complex subunit gamma; proteasome activator 28 subunit gamma; activator of multicatalytic protease subunit 3; REG-GAMMA; PA28-gamma;
Gene ID 10197
mRNA Refseq NM_005789
Protein Refseq NP_005780
MIM 605129
UniProt ID P61289

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSME3 Products

Required fields are marked with *

My Review for All PSME3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon