Recombinant Human PSMG3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PSMG3-4516H |
| Product Overview : | PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | PSMG3 (Proteasome Assembly Chaperone 3) is a Protein Coding gene. |
| Molecular Mass : | 13.1 kDa |
| AA Sequence : | MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PSMG3 proteasome assembly chaperone 3 [ Homo sapiens (human) ] |
| Official Symbol | PSMG3 |
| Synonyms | PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; PAC-3; hPAC3; proteasome assembling chaperone 3; C7orf48; |
| Gene ID | 84262 |
| mRNA Refseq | NM_032302 |
| Protein Refseq | NP_115678 |
| MIM | 617528 |
| UniProt ID | Q9BT73 |
| ◆ Recombinant Proteins | ||
| PSMG3-13608M | Recombinant Mouse PSMG3 Protein | +Inquiry |
| PSMG3-30897TH | Recombinant Human PSMG3, His-tagged | +Inquiry |
| PSMG3-0295H | Recombinant Human PSMG3 Protein (M1-W122), His/Strep tagged | +Inquiry |
| PSMG3-4360H | Recombinant Human PSMG3 Protein, GST-tagged | +Inquiry |
| PSMG3-3678R | Recombinant Rhesus monkey PSMG3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSMG3-2734HCL | Recombinant Human PSMG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMG3 Products
Required fields are marked with *
My Review for All PSMG3 Products
Required fields are marked with *
