Recombinant Human PSMG3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PSMG3-4516H |
Product Overview : | PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PSMG3 (Proteasome Assembly Chaperone 3) is a Protein Coding gene. |
Molecular Mass : | 13.1 kDa |
AA Sequence : | MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PSMG3 proteasome assembly chaperone 3 [ Homo sapiens (human) ] |
Official Symbol | PSMG3 |
Synonyms | PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; PAC-3; hPAC3; proteasome assembling chaperone 3; C7orf48; |
Gene ID | 84262 |
mRNA Refseq | NM_032302 |
Protein Refseq | NP_115678 |
MIM | 617528 |
UniProt ID | Q9BT73 |
◆ Recombinant Proteins | ||
PSMG3-4516H | Recombinant Human PSMG3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSMG3-4927C | Recombinant Chicken PSMG3 | +Inquiry |
PSMG3-7232M | Recombinant Mouse PSMG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Psmg3-5206M | Recombinant Mouse Psmg3 Protein, Myc/DDK-tagged | +Inquiry |
PSMG3-301552H | Recombinant Human PSMG3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMG3-2734HCL | Recombinant Human PSMG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMG3 Products
Required fields are marked with *
My Review for All PSMG3 Products
Required fields are marked with *