Recombinant Human PSMG3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PSMG3-4516H
• Product Overview: PSMG3 MS Standard C13 and N15-labeled recombinant protein (NP_115678) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PSMG3 (Proteasome Assembly Chaperone 3) is a Protein Coding gene.
• Molecular Mass: 13.1 kDa
• AA Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PSMG3 proteasome assembly chaperone 3 [ Homo sapiens (human) ]
• Official Symbol: PSMG3
• Synonyms: PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; PAC-3; hPAC3; proteasome assembling chaperone 3; C7orf48
• Gene ID: 84262
• mRNA Refseq: NM_032302
• Protein Refseq: NP_115678
• MIM: 617528
• UniProt ID: Q9BT73