Recombinant Human PSPN Protein, His tagged

• Cat.No.: PSPN-001H
• Product Overview: Recombinant Human PSPN Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-156 aa
• Description: This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma.
• Tag: His
• Molecular Mass: 15.4 kDa
• AA Sequence: MHHHHHHWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
• Endotoxin: <2 EU/μg by LAL
• Purity: > 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL

Gene Information

• Gene Name: PSPN persephin [ Homo sapiens (human) ]
• Official Symbol: PSPN
• Synonyms: PSPN; persephin; PSP
• Gene ID: 5623
• mRNA Refseq: NM_004158
• Protein Refseq: NP_004149
• MIM: 602921
• UniProt ID: O60542