Recombinant Human PSPN Protein, His tagged

Cat.No. : PSPN-001H
Product Overview : Recombinant Human PSPN Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 22-156 aa
Description : This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma.
Tag : His
Molecular Mass : 15.4 kDa
AA Sequence : MHHHHHHWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
Endotoxin : <2 EU/μg by LAL
Purity : > 85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL
Gene Name PSPN persephin [ Homo sapiens (human) ]
Official Symbol PSPN
Synonyms PSPN; persephin; PSP;
Gene ID 5623
mRNA Refseq NM_004158
Protein Refseq NP_004149
MIM 602921
UniProt ID O60542

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSPN Products

Required fields are marked with *

My Review for All PSPN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon