Recombinant Human PSPN Protein, His tagged
Cat.No. : | PSPN-001H |
Product Overview : | Recombinant Human PSPN Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-156 aa |
Description : | This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma. |
Tag : | His |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MHHHHHHWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG |
Endotoxin : | <2 EU/μg by LAL |
Purity : | > 85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL |
Gene Name | PSPN persephin [ Homo sapiens (human) ] |
Official Symbol | PSPN |
Synonyms | PSPN; persephin; PSP; |
Gene ID | 5623 |
mRNA Refseq | NM_004158 |
Protein Refseq | NP_004149 |
MIM | 602921 |
UniProt ID | O60542 |
◆ Recombinant Proteins | ||
PSPN-6006H | Recombinant Human PSPN Protein (Ala61-Gly156), N-His tagged | +Inquiry |
PSPN-001H | Recombinant Human PSPN Protein, His tagged | +Inquiry |
PSPN-4452R | Recombinant Rat PSPN Protein, His (Fc)-Avi-tagged | +Inquiry |
PSPN-1003H | Active Recombinant Human PSPN | +Inquiry |
PSPN-098H | Active Recombinant Human PSPN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSPN-2733HCL | Recombinant Human PSPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSPN Products
Required fields are marked with *
My Review for All PSPN Products
Required fields are marked with *