Recombinant Human PTDSS1 Protein (1-35 aa), GST-tagged
| Cat.No. : | PTDSS1-1203H |
| Product Overview : | Recombinant Human PTDSS1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-35 aa |
| Description : | Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.1 kDa |
| AA Sequence : | MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | PTDSS1 phosphatidylserine synthase 1 [ Homo sapiens ] |
| Official Symbol | PTDSS1 |
| Synonyms | PTDSS1; KIAA0024; PSS1; PSSA; PSS-1; |
| Gene ID | 9791 |
| mRNA Refseq | NM_014754 |
| Protein Refseq | NP_055569 |
| MIM | 612792 |
| UniProt ID | P48651 |
| ◆ Recombinant Proteins | ||
| PTDSS1-3503R | Recombinant Rhesus Macaque PTDSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTDSS1-2014HFL | Recombinant Full Length Human PTDSS1 Protein, C-Flag-tagged | +Inquiry |
| PTDSS1-3685R | Recombinant Rhesus monkey PTDSS1 Protein, His-tagged | +Inquiry |
| PTDSS1-4798R | Recombinant Rat PTDSS1 Protein | +Inquiry |
| RFL2916DF | Recombinant Full Length Danio Rerio Phosphatidylserine Synthase 1(Ptdss1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTDSS1-2722HCL | Recombinant Human PTDSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTDSS1 Products
Required fields are marked with *
My Review for All PTDSS1 Products
Required fields are marked with *
