Recombinant Human PTDSS1 Protein (1-35 aa), GST-tagged

Cat.No. : PTDSS1-1203H
Product Overview : Recombinant Human PTDSS1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-35 aa
Description : Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.1 kDa
AA Sequence : MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name PTDSS1 phosphatidylserine synthase 1 [ Homo sapiens ]
Official Symbol PTDSS1
Synonyms PTDSS1; KIAA0024; PSS1; PSSA; PSS-1;
Gene ID 9791
mRNA Refseq NM_014754
Protein Refseq NP_055569
MIM 612792
UniProt ID P48651

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTDSS1 Products

Required fields are marked with *

My Review for All PTDSS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon