"PTDSS1" Related Products

Expand

Recombinant Human PTDSS1 Protein (1-35 aa), GST-tagged

Cat.No. : PTDSS1-1203H
Product Overview : Recombinant Human PTDSS1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.
Description : Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.
Source : E. coli
Species : Human
Tag : GST
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.1 kDa
Protein length : 1-35 aa
AA Sequence : MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : PTDSS1 phosphatidylserine synthase 1 [ Homo sapiens ]
Official Symbol : PTDSS1
Synonyms : PTDSS1; KIAA0024; PSS1; PSSA; PSS-1;
Gene ID : 9791
mRNA Refseq : NM_014754
Protein Refseq : NP_055569
MIM : 612792
UniProt ID : P48651

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.