Recombinant Human PTGER3 protein, His-tagged

Cat.No. : PTGER3-854H
Product Overview : Recombinant Human PTGER3 protein(P43115)(1-53aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-53a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 12.5 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
Gene Name PTGER3 prostaglandin E receptor 3 (subtype EP3) [ Homo sapiens ]
Official Symbol PTGER3
Synonyms PTGER3; prostaglandin E receptor 3 (subtype EP3); prostaglandin E2 receptor EP3 subtype; EP3; prostanoid EP3 receptor; PGE receptor, EP3 subtype; PGE2 receptor EP3 subtype; prostaglandin receptor (PGE-2); prostaglandin E receotor EP3 subtype 3 isoform; EP3e; EP3-I; EP3-II; EP3-IV; PGE2-R; EP3-III; MGC27302; MGC141828; MGC141829;
Gene ID 5733
mRNA Refseq NM_001126044
Protein Refseq NP_001119516
MIM 176806
UniProt ID P43115

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGER3 Products

Required fields are marked with *

My Review for All PTGER3 Products

Required fields are marked with *

0
cart-icon
0
compare icon