Recombinant Human PTGER3 protein, His-tagged
Cat.No. : | PTGER3-854H |
Product Overview : | Recombinant Human PTGER3 protein(P43115)(1-53aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-53a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA |
Gene Name | PTGER3 prostaglandin E receptor 3 (subtype EP3) [ Homo sapiens ] |
Official Symbol | PTGER3 |
Synonyms | PTGER3; prostaglandin E receptor 3 (subtype EP3); prostaglandin E2 receptor EP3 subtype; EP3; prostanoid EP3 receptor; PGE receptor, EP3 subtype; PGE2 receptor EP3 subtype; prostaglandin receptor (PGE-2); prostaglandin E receotor EP3 subtype 3 isoform; EP3e; EP3-I; EP3-II; EP3-IV; PGE2-R; EP3-III; MGC27302; MGC141828; MGC141829; |
Gene ID | 5733 |
mRNA Refseq | NM_001126044 |
Protein Refseq | NP_001119516 |
MIM | 176806 |
UniProt ID | P43115 |
◆ Recombinant Proteins | ||
PTGER3-1137HFL | Recombinant Human PTGER3 protein, His&Flag-tagged | +Inquiry |
PTGER3-371H | Recombinant Human PTGER3 Protein, His/GST-tagged | +Inquiry |
PTGER3-4467R | Recombinant Rat PTGER3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGER3-342H | Recombinant Human PTGER3 | +Inquiry |
PTGER3-4808R | Recombinant Rat PTGER3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGER3-2717HCL | Recombinant Human PTGER3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGER3 Products
Required fields are marked with *
My Review for All PTGER3 Products
Required fields are marked with *
0
Inquiry Basket