Recombinant Human PTGER3 protein, His-tagged
| Cat.No. : | PTGER3-854H |
| Product Overview : | Recombinant Human PTGER3 protein(P43115)(1-53aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-53a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 12.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA |
| Gene Name | PTGER3 prostaglandin E receptor 3 (subtype EP3) [ Homo sapiens ] |
| Official Symbol | PTGER3 |
| Synonyms | PTGER3; prostaglandin E receptor 3 (subtype EP3); prostaglandin E2 receptor EP3 subtype; EP3; prostanoid EP3 receptor; PGE receptor, EP3 subtype; PGE2 receptor EP3 subtype; prostaglandin receptor (PGE-2); prostaglandin E receotor EP3 subtype 3 isoform; EP3e; EP3-I; EP3-II; EP3-IV; PGE2-R; EP3-III; MGC27302; MGC141828; MGC141829; |
| Gene ID | 5733 |
| mRNA Refseq | NM_001126044 |
| Protein Refseq | NP_001119516 |
| MIM | 176806 |
| UniProt ID | P43115 |
| ◆ Recombinant Proteins | ||
| PTGER3-3417C | Recombinant Chicken PTGER3 | +Inquiry |
| PTGER3-371H | Recombinant Human PTGER3 Protein, His/GST-tagged | +Inquiry |
| RFL7617MF | Recombinant Full Length Mouse Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged | +Inquiry |
| PTGER3-854H | Recombinant Human PTGER3 protein, His-tagged | +Inquiry |
| RFL33900BF | Recombinant Full Length Bovine Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTGER3-2717HCL | Recombinant Human PTGER3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGER3 Products
Required fields are marked with *
My Review for All PTGER3 Products
Required fields are marked with *
