Recombinant Human PTGES3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PTGES3-4440H
Product Overview : PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.
Molecular Mass : 18.7 kDa
AA Sequence : MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PTGES3 prostaglandin E synthase 3 [ Homo sapiens (human) ]
Official Symbol PTGES3
Synonyms PTGES3; prostaglandin E synthase 3 (cytosolic); prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; telomerase-binding protein p23; progesterone receptor complex p23; cytosolic prostaglandin E synthase; cytosolic prostaglandin E2 synthase; unactive progesterone receptor, 23 kD; P23;
Gene ID 10728
mRNA Refseq NM_006601
Protein Refseq NP_006592
MIM 607061
UniProt ID Q15185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGES3 Products

Required fields are marked with *

My Review for All PTGES3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon