Recombinant Human PTGES3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PTGES3-4440H |
| Product Overview : | PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. |
| Molecular Mass : | 18.7 kDa |
| AA Sequence : | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PTGES3 prostaglandin E synthase 3 [ Homo sapiens (human) ] |
| Official Symbol | PTGES3 |
| Synonyms | PTGES3; prostaglandin E synthase 3 (cytosolic); prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; telomerase-binding protein p23; progesterone receptor complex p23; cytosolic prostaglandin E synthase; cytosolic prostaglandin E2 synthase; unactive progesterone receptor, 23 kD; P23; |
| Gene ID | 10728 |
| mRNA Refseq | NM_006601 |
| Protein Refseq | NP_006592 |
| MIM | 607061 |
| UniProt ID | Q15185 |
| ◆ Recombinant Proteins | ||
| PTGES3-4704C | Recombinant Chicken PTGES3 | +Inquiry |
| PTGES3-30051TH | Recombinant Human PTGES3 | +Inquiry |
| PTGES3-2568H | Recombinant Full Length Human PTGES3 Protein (1-160 aa), His-tagged | +Inquiry |
| PTGES3-478H | Recombinant Full Length Human Prostaglandin E Synthase 3 (Cytosolic) / PTGES3 Protein | +Inquiry |
| PTGES3-829C | Recombinant Cynomolgus PTGES3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTGES3-2712HCL | Recombinant Human PTGES3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGES3 Products
Required fields are marked with *
My Review for All PTGES3 Products
Required fields are marked with *
