Recombinant Human PTH2R protein, His-SUMO-tagged
Cat.No. : | PTH2R-3387H |
Product Overview : | Recombinant Human PTH2R protein(P49190)(27-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-145aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PTH2R parathyroid hormone 2 receptor [ Homo sapiens ] |
Official Symbol | PTH2R |
Synonyms | PTH2R; parathyroid hormone 2 receptor; parathyroid hormone receptor 2 , PTHR2; PTH2 receptor; parathyroid hormone receptor 2; PTHR2; |
Gene ID | 5746 |
mRNA Refseq | NM_005048 |
Protein Refseq | NP_005039 |
MIM | 601469 |
UniProt ID | P49190 |
◆ Recombinant Proteins | ||
PTH2R-3387H | Recombinant Human PTH2R protein, His-SUMO-tagged | +Inquiry |
PTH2R-8954Z | Recombinant Zebrafish PTH2R | +Inquiry |
PTH2R-32H | Recombinant Human PTH2R protein | +Inquiry |
PTH2R-7264M | Recombinant Mouse PTH2R Protein, His (Fc)-Avi-tagged | +Inquiry |
PTH2R-13655M | Recombinant Mouse PTH2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTH2R-2704HCL | Recombinant Human PTH2R 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTH2R Products
Required fields are marked with *
My Review for All PTH2R Products
Required fields are marked with *